A database of hormones and their receptors

Peptide Hormone

HMRbase accession number	10016
Swiss-prot Accession number	P13189 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Callorhynchus milii (Elephant shark) (Elephantfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3443
References	1 PubMed abstract 2690815
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSEGTFSSDYSKYLDSRRAKDFVQWLMST
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

HMRbase accession number	10804
Swiss-prot Accession number	P13190 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Callorhynchus milii (Elephant shark) (Elephantfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	89 Amino acids
Molecular weight	10147
References	1 Gieseg M.A., Swarbrick P.A., Perko L., Powell R.J., Cutfield J.F.; "A monobasic proinsulin processing site."; Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases. 2 PubMed abstract 2690815
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VPTQRLCGSHLVDALYFVCGERGFFYSPKQI
Position of mature hormone in Pre-Hormone protein	31 Residues from position (1-31)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

HMRbase accession number	10805
Swiss-prot Accession number	P13190 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Callorhynchus milii (Elephant shark) (Elephantfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	89 Amino acids
Molecular weight	10147
References	1 Gieseg M.A., Swarbrick P.A., Perko L., Powell R.J., Cutfield J.F.; "A monobasic proinsulin processing site."; Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases. 2 PubMed abstract 2690815
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLVNLEGYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (69-89)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated